PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr027204.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 530aa    MW: 58984.4 Da    PI: 6.455
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr027204.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.61e-1131575281374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkfshl 96 
                  lv+lL++cAeav+ +d++ a+alL++l  +a   g+++qR+a++f+++La+rla  ++  +  +  s+ s k+   +++  al+l +e++P ++f+h+
  Pbr027204.1 157 LVQLLIACAEAVACRDKSHASALLSELWANALVFGSSFQRVASCFVQGLANRLALVQPLGAVGFIGSAMSMKDfaLDKKEEALRLVYEICPHIQFGHF 254
                  689**************************************************9855543333333333333344999999***************** PP

         GRAS  97 taNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                  +aN+ Ilea+ege  vH++D++++    +G QW  L+q+La+R+++pp +lRiTgvg      +++l+ +g  L+ +Ae+lg+++ef+v v+++le+l
  Pbr027204.1 255 VANSSILEAFEGEFFVHVVDLGMTlglpHGDQWRGLIQSLATRTGQPPtRLRITGVGL----CSDRLQIIGGELEAYAESLGINLEFSV-VESNLENL 347
                  ********************99873333667*************88877*********....9*************************9.7******* PP

         GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                  ++e++++  gE+l+Vn++lqlh +++es    +   +vL+++ +lsPk++v+veq+++hn++ Fl rf+eal+yysa+fdsl+a lp+ +  r+k+E+
  Pbr027204.1 348 RPEDIKMYDGEVLVVNSILQLHCVVKESRGALN---SVLQMIHELSPKILVLVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDAMLPKYDTRRAKMEQ 442
                  *************************88877777...8************************************************************* PP

         GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +++++ei+n+++ceg +r+erhe++ +Wr+r+++aGF++ p++  + +qak  l ++k  +gy++ ee+g+lvlgW+++p+v++S+W+
  Pbr027204.1 443 FYFAEEIKNIISCEGPARVERHERVDQWRRRMSRAGFQATPIK--MLSQAKQWLGNIKvCEGYTIMEEKGCLVLGWNSKPIVAASCWK 528
                  *****************************************96..79****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.05131509IPR005202Transcription factor GRAS
PfamPF035143.5E-111157528IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MGPNRNFLPK EYMINNERTN KRSVLDLITH SAASAMPCYP YPYTPFLEEG ATVSILPYSD  60
ESGDHKRLKK NINISDSHNS LYSGGGSESS CITDISLSRS SSANSFKTLP RLHFRDHIWT  120
YSQRYLAAEA VEEAATAMSN AKENRAEEDG TADGMRLVQL LIACAEAVAC RDKSHASALL  180
SELWANALVF GSSFQRVASC FVQGLANRLA LVQPLGAVGF IGSAMSMKDF ALDKKEEALR  240
LVYEICPHIQ FGHFVANSSI LEAFEGEFFV HVVDLGMTLG LPHGDQWRGL IQSLATRTGQ  300
PPTRLRITGV GLCSDRLQII GGELEAYAES LGINLEFSVV ESNLENLRPE DIKMYDGEVL  360
VVNSILQLHC VVKESRGALN SVLQMIHELS PKILVLVEQD SSHNGPFFLG RFMEALHYYS  420
AIFDSLDAML PKYDTRRAKM EQFYFAEEIK NIISCEGPAR VERHERVDQW RRRMSRAGFQ  480
ATPIKMLSQA KQWLGNIKVC EGYTIMEEKG CLVLGWNSKP IVAASCWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-491575284375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009336573.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5WBT20.0M5WBT2_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-82RGA-like 1